Turmeric & Ginger Dal
gluten-freedairy-freevegetarianwarmingtraditional

Turmeric & Ginger Dal

SKU: M0005

Organic red lentils (the kind that cook down to a creamy consistency) are simmered in our 48-hour bone broth and layered with caramelized onions, fresh ginger, fresh turmeric, garlic and our from-scratch garam masala.

Postpartum Benefits:

  • Fiber from red lentils, sweet potatoes, and vegetables
  • Plant protein from organic red lentils
  • Protein, fat, and fiber built into one bowl
  • Turmeric and ginger — two of the most-studied roots in the culinary world
  • Lentils are a food source of folate, iron, and magnesium

Key Ingredients:

Organic red lentilsOrganic caramelized onionsFresh turmeric rhizomeFresh gingerFrom-scratch garam masalaSmoked organic sweet potatoes48-hour bone broth base
Quantity:
1